StudentShare
Contact Us
Sign In / Sign Up for FREE
Search
Go to advanced search...
Free

Pursue MS in Computational Finance - Essay Example

Comments (0) Cite this document
Summary
I still remember my mathematics classes of native school days as if they have just passed by. While the rest of my class would flounder in their attempts to solve labyrinthine mathematical problems, I would complete them accurately with relative ease. Since the very beginning of my academic life, I have possessed acumen in the science of numbers…
Download full paperFile format: .doc, available for editing
GRAB THE BEST PAPER93.1% of users find it useful
Pursue MS in Computational Finance
Read TextPreview

Extract of sample "Pursue MS in Computational Finance"

ment of Purpose Samar (Second Objective: Pursue MS in Computational Finance
University: (University Name)
As part of my endeavor to pursue Masters of Science in Computational Finance field, I am presenting my Statement of Purpose.
I still remember my mathematics classes of native school days as if they have just passed by. While the rest of my class would flounder in their attempts to solve labyrinthine mathematical problems, I would complete them accurately with relative ease. Since the very beginning of my academic life, I have possessed acumen in the science of numbers. I am a firm believer that the universal language is not punctuated by accents or vowels originated from a particular geography; instead it is composed of numbers. Numbers and their manipulations are part of one uniform logical framework which defines reality and scientific truth. However the biggest revelation that I experienced was when I came across the concepts of finance, economics and banking during my under graduation. I began to realize the true importance of numbers. That was when I began comprehending the magnitude of services that mathematics could provide. I immediately realized that a domain that blends mathematics and finance was my future.
My Initial Experiences with Finance
Even before I completed my Class X, I had achieved a high level of proficiency in various nuances of mathematics, much advanced than required by convention. I spent vast amounts of time identifying the roles that mathematics plays in everyday life. Of the various applications with their pith as numbers, I was most fascinated by Finance and its related domains. Consequently, I took up Finance as my major subject for my under-graduation at Georgia State University.
The subjects that I learnt during my undergraduate course have taught me the art of formal and logical thinking. My passion for finance only escalated from day one of my under-graduation. Some of my favorite subjects were Mathematics, Finance, Economics and Risk Management. I took several interesting courses in finance and completed all the required credits successfully. I have also walked an extra step by acquiring the knowledge about the prerequisite courses in calculus, linear algebra and differential equations which I previously lacked.
Apart from successfully completing all the mandated course credits, I kept myself abreast with the latest happenings in the field of finance by constantly going through several White Papers, Online Courses and Video Lectures. I have drafted a project report on portfolio management for a Class of 4000, dealing with issues such as 'how the portfolio must be performed', 'its investments philosophies' and 'weight distributions in different industries'. I have also written successful project reports in the field of Strategic Management. My department also awarded me tuition waivers for last three semesters, to acknowledge my all-round performance during under-graduation.
Objective
Although my undergraduate course has imbibed a lot of knowledge in me, I have several unanswered questions in my mind. I wish to fulfill all my quests in acquiring deeper insights in the amazing field of finance. I have always wanted a chance to get involved in advanced research with genius Professors and Lecturers. I thoroughly adore the academic environment and feel motivated with people who are as compelled as I am to educate and challenge themselves. No achievement can quench my insatiable thirst for self-improvement. Most importantly I want to nourish my quantitative computing skills. By pursuing an advanced degree in a field that incorporates computation, will justify my alacrity in quantitative computations. A formal training from (University Name) will widen my scope and elevate my existing skills of finance to greater heights. Finance is a dynamic and variable field. It is a field that is continuously researched and upgraded. Graduate studies at your esteemed university will equip me with modern financial instruments and techniques such as Brownian Motion, Monte Carlo Simulation, Stochastic Calculus and Partial Differential Equations in the decision making process of strategic issues such as Risk Management, Risk Diversification, Hedging Risks etc. 'Designing Financial Variables structured and altered to client needs', 'Formulating and Pricing Collateralized Mortgage Obligations' and 'Asset Backed Securities', would be the things that I would like to master during my graduation.
I am sure I will be able to contribute greatly to my class and the university as a whole. I have a sound knowledge about the dynamics of Bombay Stock Exchange and I can network my prospective classmates with the biggest movers in the Indian finance industry.
I have a sound idea about the courses and research opportunities offered by your esteemed university. I am sure, by completing my Masters of Science degree from (University Name), I will possess all the knowledge and credentials needed for a successful career in the various domains of Finance.
Future Plans
My long term ambition is to establish and manage my own investment bank. However, to achieve this goal, I would like to work for a substantial period of time in the existing investment banking industry. Once I graduate, I would want to work for a leading investment bank with which I can attain experience in and exposure to different areas of concentration such as equity, foreign exchange, derivatives and fixed income.
Investment Banking is a challenging industry and only the bests in the business survive. I believe I will possess all the skills; both technical and non-technical, those are mandated by this critical job down the line.
In Conclusion
I bring with me, strong grasp of fundamentals in the field of Pre Requisite Mathematics, Finance and subjects of Economics. On completion of my Masters degree, I hope to take back with me sound knowledge in advanced courses in the field of Computational Finance, ever lasting bonding with my professors and batch mates and unforgettable memories of an excellent campus life. I earnestly hope that I am considered eligible for MS program at (University Name) which would open new doors and a whole new range of exciting opportunities for me. Read More
Cite this document
  • APA
  • MLA
  • CHICAGO
(“Pursue MS in Computational Finance Essay Example | Topics and Well Written Essays - 500 words”, n.d.)
Pursue MS in Computational Finance Essay Example | Topics and Well Written Essays - 500 words. Retrieved from https://studentshare.org/miscellaneous/1506609-pursue-ms-in-computational-finance
(Pursue MS in Computational Finance Essay Example | Topics and Well Written Essays - 500 Words)
Pursue MS in Computational Finance Essay Example | Topics and Well Written Essays - 500 Words. https://studentshare.org/miscellaneous/1506609-pursue-ms-in-computational-finance.
“Pursue MS in Computational Finance Essay Example | Topics and Well Written Essays - 500 Words”, n.d. https://studentshare.org/miscellaneous/1506609-pursue-ms-in-computational-finance.
  • Cited: 0 times
Comments (0)
Click to create a comment or rate a document

CHECK THESE SAMPLES OF Pursue MS in Computational Finance

MS Excel as a Tool for Interpreting Data

...1. Describe ways in which the use of MS Excel as a tool for interpreting data can be used by a manager of an organization. Microsoft Excel is a toolthat the various members of an organization utilize for various purposes and reasons. Among the most prominent users of Excel are the managers who happen to serve as the decision-makers in the firm. These people gain the most from the numerous tools that the software offers its users. Managers can utilize Excel in several ways and for several scenarios as well. Primarily though, the spreadsheet is most valuable when managers ponder on and engage in the decision making process. Its value lies in the fact that it is a highly efficient tool for analyzing data. Since the decisions that managers...
2 Pages(500 words)Essay

Business Finance, Computational and mini essay question

... into consideration that sources of risks can be though of as related to economy-wide factors such as inflation and changes in aggregate output. Instead of calculating a single beta like CAPM, APT calculates many betas by estimating the sensitivity of an asset's return to changes in each factor. Arbitrage Pricing Theory thus indicates that the risk premium for an asset is related to the risk premium for each factor and that an asset's sensitivity to each factor increases, its risk premium will increase as well. REFERENCE: Ross, Stephen A. (1977). The Capital Asset Pricing Model (CAPM), Short-sale Restrictions and Related Issues, Journal of Finance, 32 (177)... Sensible has recently sold her holiday home for the sum of 100,000 and is...
2 Pages(500 words)Essay

Personal Statement for Masters Degree of Computational Finance

As I walk down the crowded streets of downtown Chicago, I am always left wonderstruck at the high rising skyscrapers. I imagine the elegant office interiors and debonair lives of CEOs and Presidents of various affluent companies nested in these massive buildings. And then I stand there feeling totally elated because I know it is the wonderful field of Finance that has resulted in these modern wonders. From a singleton in a society to the society itself and consequently the world at large; everyone is affected by the variables of finance. And it is this very power and reaches that the field of finance possesses, inspires me every minute to master its various nuances.
Whenever I retrospect my own life, I distinctly see the rolle...
6 Pages(1500 words)Essay

ICP-MS

The determination of Se should be done by ICP-MS and not by DRC mode because the response obtained for Se 82 in DRC shows lower response as compared to good counts in ICP-MS. The chances of error are less when ICP-MS is employed for estimation of
3 Pages(750 words)Lab Report

Computational Fluid Dynamics

... of values of and at time zero at and . If we wanted to work out the values of and at time then we would need to do this on the basis of values of and at time zero at and , see figure 2. Figure 2: It shows the characteristic method in action. So the smaller the time step is made, the finer the spatial grid must be and vice versa: must hold. This constraint means that the computation time will vary with the square of either the number of time-steps or spatial segments chosen. We have adopted the following physical properties for both pipe and fluid: Pipe properties: Diameter Length Wall thickness Elasticity Lame coefficient Roughness Fluid properties: assumed constant, i.e. independent...
5 Pages(1250 words)Outline

Computational Phylogenetic

UMUC BIOT630 Lecture 7 Exercise – “Due Version” MOBYLE Portal url = http mobyle.pasteur.fr/cgi-bin/portal.py# Question Using the following MSA:
>Human/1292
MGRQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGIL
IAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWHFADNQLFVSGPNGTA
GIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNP
ARDFGPRLFTALAGWGSAVFTTGQHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQ--PPPSNEEENVKLAHV
KHKEQI
>Monkey/1-292
MGRQKELMSRCGEMLHIRHRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGIL
IAGQVSGAHLNPAVTFAMCFLAREPWIKLPVYTLAQTLGAFLGAGIVFGLYYDAIWGFADNQLFVSGPNGTA
GIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNP
ARDFGPRLFTALAGWGSK...
2 Pages(500 words)Essay

Pursue litigation

...Pursue Litigation The law is quite clear on actions of any individual whose rights have been infringed upon. The most common of these infringements is any wrongful act done on one or his reputation. In law, this is referred to as a tort. The law provides for an injured party to bring forward a civil law suit which determines whether the act warrants compensation or not. In case the offending party is found to be guilty, then they are required to compensate the injured persons or provide for compensation for the property. Tort law is not static but continually dynamic to incorporate changes that take place in the wider society (Cheeseman, 2010). This ensures that people do not take advantage of legal loop holes to cause damage to others...
2 Pages(500 words)Essay

Computational recruits lab

...Computational RC circuit Lab Introduction In this lab, the major objective was to simulate a RC circuit that could allow us to measure the current and voltage across the resistor and capacitor. Meeting the above objective provided a platform for exploring how charge on capacitor changes with time when different parameters were varied. Apart from a graph of charge on capacitor against time, another one for current against time was also plotted to current is affected by change on charge on capacitor. This could the give an immediate overview about the activities of a capacitor in a circuit. Parameters that were changed to meet the objective of this study includes charge across, capacitance and resistance. Conclusion Both simulation...
1 Pages(250 words)Lab Report

Computational Exercise 3 : Cyclotron motion

...Computational Exercise 3 Worksheet: Cyclotron motion What is cyclotron motion? (1pt) A charged particle is moving in the magnetic field with velocity. It moves in a circle at the end 2 Why does a charged particle moving in a direction perpendicular to a magnetic field move in a circle? (1pt) Taking the equation of, the cross product between will produce a perpendicular force for the magnetic field. 3 What is the force from the magnetic field on a charged particle moving parallel to a magnetic field? What is the force on a charged stationary particle in a magnetic field? (1pt) forces on charged stationary particles will be 4 Write down the magnitude of the Lorentz force for a particle in a magnetic field. Write down the equation...
1 Pages(250 words)Lab Report

Computational Fluid Dynamic

... Introduction Computational fluid Dynamics (CFD) can be described as the art of replacing existing PDE systems with a set of algebraic equations which can be solved using digital computers. Computational fluid Dynamics (CFD) usually provides a qualitative prediction of the fluid flow by the means of mathematical modeling, numerical methods and software tools (Ferziger and Peric, 2006). CFD enables engineers and scientists to perform numerical environments in virtual flow laboratories. Computational fluid Dynamics (CFD) has a wide range of uses in the engineering and scientific research. It can be used by architects to produce 3D models of their buildings, by engineers to model the production of their outputs and also by designers...
11 Pages(2750 words)Assignment

Strategic Finance Management: Gallaher Group Plc

Gallagher's comprehensive brand portfolio includes Benson & Hedges, Silk Cut, Mayfair, Sovereign, Sobranie, Dorchester, Troika, LD, Memphis, Meine Sorte, Ronson, Blend, Hamlet, Old Holborn, Amber Leaf, and Condor. The Group employs over 11,000 people, with manufacturing plants in Austria, Kazakhstan, Poland, Romania, Russia, Sweden, Ukraine, and the UK. Gallagher shares are listed on the London Stock Exchange and its ADRs are traded on the New York Stock Exchange. (Company Snapshot).
Gallaher Group Plus head office is located in Weybridge in the UK and the Group has four divisions. These comprise the United Kingdom, Europe, Commonwealth of Independent States (CIS) and the Rest of the World. The United Kingdom division is...
16 Pages(4000 words)Case Study

Principles of Corporate Finance

The rationale for choosing these two business organizations is simple. It should be noted that both of them are regarded as important players in the global pharmaceutical industry. AstraZeneca is involved in the “discovery, development, manufacture, and marketing of prescription pharmaceuticals primarily for the cardiovascular, gastrointestinal, neuroscience, oncology, respiratory and inflammation, and infection areas in the healthcare sector worldwide” (AstraZeneca Plc Profile 2006). GSK is the major competitor of Astrazeneca as the former engages in the “creation, discovery, development, manufacture, and marketing of pharmaceutical and consumer health-related products worldwide” (GlaxoSmithKline Plc Profi...
7 Pages(1750 words)Term Paper

Contemporary Managerial Issues in Accounts and Finance

Political theorists like Veblen argued that the separation of corporate ownership from control generates a transfer of power from a minority of stockholders to a group of decisive owners who have the control over the way of access to credit and finance (Roe, 1994, p. 5).
However, contemporary analysts of corporate power contested that dominance and ownership in modern corporations have shifted to a property-less group of managers. Consequently, this current shift of power and control in large modern corporations could usher in ultimate preoccupation over profit rather than non-financial motives. Furthermore, the separation of power and ownership will lead to the destruction of the traditional legal theory of property which en...
23 Pages(5750 words)Literature review

Fundamentals of Finance

It is the size of the company that decides the role of financial management in a firm. In small firms, financial management is handled normally by the accounting department but in large entities, a separate department under the leadership of its CFO takes care of its financial management. Broadly “the financial manager of a firm plays an important role in a company’s goals, policies and financial success. The financial manager’s responsibility includes financial analysis and planning- determining the proper amount of funds to employ in the firm, i.e. designating the size of a firm and its growth; investment decisions- the efficient allocation of funds to specific assets; financing and capital structure decisions-...
11 Pages(2750 words)Assignment

International Finance Organizations of Foreign Exchange Management

... before deciding on the various hedging strategies. Assessment of political risk, choice of hedging instruments, cost, leverage as well as firm size are some of the determinants of the deciding on any hedging strategies. Increasing globalization and associated volatility of foreign exchange exposure therefore requires that the organizations must hedge themselves properly against the potential losses to be incurred due to abnormal movements into the values of the foreign currencies. Bibliography 1. Allayannis, G., & Eli, O. (2001). Exchange rate exposure, hedging, and the. Journal of International Money and Finance , 20, 273-296. 2. Allayannis, G., & Weston, J. P. (2001). The Use of Foreign Currency Derivatives and Firm Market Value...
8 Pages(2000 words)Research Paper

Corporate Finance: Cables & Wires Plc

...Corporate Finance Introduction The company selected for the purpose of this assignment is Cables & Wires Plc, one of the FTSE 100 companies. The first part evaluates the weighted average cost of capital employed in Cables & Wires Plc as at 31March 2008. The second part of the write up takes into account the performance of cash flows in Cable & Wires Plc over the previous two years; and the third portion is the consideration of several factors involved in selecting a discount rate while making a decision about capital investment for the entity. a) Calculations of Weighted Average Cost of Capital A company’s cost of capital is the weighted average cost of various sources of long term finance used by the company, viz., equity, preference...
6 Pages(1500 words)Assignment

Personal Development in Accounting and Finance

...Personal Development in Accounting & Finance TABLE OF CONTENTS My Personality ……………………………………………………………..1 Job motivation and career development …………………………………….2 MBTI Personality Type & Strength and Weakness………………………….3 Review of Career and skills and abilities……………………………………..4 Job profile and Chosen C.V…………………………………………………..5 SAF draft form and skill and abilities related to it……………………………..6 Personality Development inAccounting and Finance MY Personality I believe that there are various dimensions to my personality and it would be complex to put forward it into a narrow context. I would like to depict myself as a unique individual with a distinct thinking and understanding. I have this outstanding quality of taking life as it comes...
6 Pages(1500 words)Essay

Emergence of the Middle East and North Africa Region as the Islamic Finance Hub

The enterprise solutions of Bloomberg dwell upon the core strength of the company i.e. to provide customers with access to data and an opportunity to integrate, manage, administer, and distribute the information across a variety of networks and channels very effectively and efficiently. The company provides information beyond finance to the decision-makers in a variety of industries using its engines including Bloomberg BNA, Bloomberg New Energy Finance, and Bloomberg Government. Bloomberg News covers the world with the number of news and multimedia professionals exceeding 2,400 at 150 bureaus located in 73 different countries (“Bloomberg Facts”). Bloomberg News achieves this by being broadcast through the Bloomberg Pr...
12 Pages(3000 words)Assignment

Health Care Finance in Saudi Arabia

...Health Care Finance in Saudi Arabia Government Efforts to Find other Sources for Budget Allocations to Spend on the Health Sector The government is advocating for the initiation of multiple financial sources through the Cooperative Health Insurance program. This is coupled with the compulsory insurance scheme for the employed under a system called Compulsory Employment-Based Health Insurance. Such schemes have made the insurance sector a major per taker in the financial matters relating to the health sector. A number of expenses that would have been the government’s responsibility are covered by the insurance sector. Therefore, insurance schemes are one of the alternatives used to finance the health sector. The role of civil charities...
7 Pages(1750 words)Assignment

Analysis of Literature about Corporate Finance, Financial Accounting I and Financial Accounting II

...Task 2 Literature Review of Task 2 Literature Review Introduction The section of the report discusses past writings related to the capital structure, revenue recognition, and treatments of the current assets by companies. The books and articles are helpful in highlighting the importance, treatments, and difficulties while analysing the selected three topics that are related to Corporate Finance, Financial Accounting I and Financial Accounting II. Financial Accounting I Treatment of Current Assets Stickney, Weil, Schipper, & Francis (2009) have highlighted that current assets are recorded in the balance sheet of the company. They represent those assets that are used to generate income for the business. Life of current assets is short i.e...
10 Pages(2500 words)Literature review
sponsored ads
We use cookies to create the best experience for you. Keep on browsing if you are OK with that, or find out how to manage cookies.

Let us find you another Essay on topic Pursue MS in Computational Finance for FREE!

Contact Us